DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and Rpt5

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_524464.1 Gene:Rpt5 / 42805 FlyBaseID:FBgn0028684 Length:428 Species:Drosophila melanogaster


Alignment Length:472 Identity:134/472 - (28%)
Similarity:221/472 - (46%) Gaps:78/472 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 TLDDDEPSEDAGETPVPDSKGEETAKDAEAE-----QKVDGD-----------------KETSAK 537
            ||:|....|| ||    :|.|||..:.:..|     :.:|.:                 :....|
  Fly     4 TLEDKSIWED-GE----ESLGEEVMRMSTDEIVSRTRLMDNEIKIMKSEVIRITHEIQAQNEKIK 63

  Fly   538 DKSEGDSPNIETPKKATNGNSSIK-SPQKTPKKSAEKPTDAAMDV-DNVAPEEPKKAVEQEVDSS 600
            |.:|....|...|...:|....:. .||       |:..|.::.| ||      ::..:..|..:
  Fly    64 DNTEKIKVNKTLPYLVSNVIELLDVDPQ-------EEEDDGSVTVLDN------QRKGKCAVIKT 115

  Fly   601 SSNDEYYEPTLAELTNFLDNPPEEFADPNFCLTLI------DFVDAIKVMQPSAKREGFITVPDT 659
            |:...|:.|.:. |.:.....|.:....|....||      ::...:|.|:...:       |..
  Fly   116 STRQAYFLPVIG-LVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDER-------PTE 172

  Fly   660 TWDDIGALEKIREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGINF 724
            .:.|||.|:|..:||..||:.|:.:.|..:.||:..|.||||.||||.||||||:|.|.:....|
  Fly   173 QYSDIGGLDKQIQELIEAVVLPMTHKEKFKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTF 237

  Fly   725 ISVKGPELMNMYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGD-GNNSGTRIVNQL 788
            :.:.||:|:.|::|:..:.||..|..|:..||.:||.||.|::..||.|... |:....|.:.:|
  Fly   238 LKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLEL 302

  Fly   789 LTEMDGVEERKGVYILAATNRPDIIDPAILRPGRLDTILYVGFPEQSERTEILKATTKNGKRPVL 853
            |.::||......:.::|||||.||:|||:||.||||..:....|.:..|..|::.   :.::..:
  Fly   303 LNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEARARIMQI---HSRKMNV 364

  Fly   854 ADDVDLDEIAAQTEGYTGADLAGLVKQASMFSLRQSLNNGDTNLDDLCVRSQHFQEALQQLRPSV 918
            ::||:.:|::..|:.:.||....:..:|.|.:||:|.|:         |..:.|.:|:.::    
  Fly   365 SNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRSANS---------VTHEDFMDAIMEV---- 416

  Fly   919 NEQDRKIYDKLRLKYAA 935
              |.:|   |..|.|.|
  Fly   417 --QAKK---KANLNYYA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 128/454 (28%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 19/36 (53%)
AAA 699..830 CDD:278434 57/131 (44%)
Rpt5NP_524464.1 RPT1 33..421 CDD:224143 118/429 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.