DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and pch2

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster


Alignment Length:414 Identity:105/414 - (25%)
Similarity:172/414 - (41%) Gaps:83/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 NIETPKKATNGNSSIKSPQKTPKKSAEKPTDAAMDVDNVAPEEPKKAVEQEVDSSSSNDEYYEPT 610
            |:||..||     ..::.:|.|:..:..|...|...::|      .:|..|.|:..     .:|.
  Fly    29 NVETALKA-----YFQTARKLPRNVSFLPDLTAEQTEHV------HSVLLERDNGG-----VQPL 77

  Fly   611 LAELT----NFLDNPPEE-----FADPNFCLTLIDFVDAIKVMQPSAKREGFITVPDTTWDDI-- 664
            ....|    :|....|||     |:.......:...|.|...:.|:|:..|.       |:::  
  Fly    78 KVAETKFRFHFYATRPEEGQLGLFSGEEGSDGIDSIVAASHALLPAAQFVGL-------WENLIY 135

  Fly   665 --GALEKIREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGI----- 722
              |..||:   ||.|:.|.:.....::...:.....:||.||||.|||.|.||:|.:..|     
  Fly   136 ETGLKEKL---LKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIRTQGS 197

  Fly   723 ----NFISVKGPELMNMYVGESERAVRACFQRAR------NSAPCVIFFDEFDSLCPKRSD-GGD 776
                :.:.:....|.:.:..||.:.|...|.:..      |:..||: .||.:||...||. ..:
  Fly   198 YAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVL-IDEVESLAYARSAMSSN 261

  Fly   777 GNNSGTRIVNQLLTEMDGVEERKGVYILAATNRPDIIDPAILRPGRLDTILYVGFPEQSERTEIL 841
            ......|:||.:||::|.::....|.|||.:|....||.|.:  .|.|..|::|:|..|...||.
  Fly   262 EPRDAMRVVNAVLTQLDSLKTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYPGISAIREIY 324

  Fly   842 KATTKN----G--KRPVL-ADDVD---LDEIAAQTEGYTGADLAGL-------VKQASMFSLRQS 889
            |.....    |  :|.|| ::|.:   |.::|.::.|.:|..|..|       ...:::|.|.|.
  Fly   325 KGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKLPLLAHAQYTSSTLFELDQK 389

  Fly   890 LNNGDTNLDDLCVRSQHFQEALQQ 913
            ::..|. ||.:.       |||:|
  Fly   390 ISLSDF-LDAML-------EALEQ 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 105/414 (25%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 12/36 (33%)
AAA 699..830 CDD:278434 45/146 (31%)
pch2NP_001287235.1 AAA 166..315 CDD:214640 46/151 (30%)
AAA 169..314 CDD:278434 45/147 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.