DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and nsfa

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:XP_021325418.1 Gene:nsfa / 368483 ZFINID:ZDB-GENE-030616-37 Length:747 Species:Danio rerio


Alignment Length:305 Identity:107/305 - (35%)
Similarity:167/305 - (54%) Gaps:32/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   650 REGFITVPDTTWD----DIGALEK-IREELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGK 709
            :|...|:.:..|:    .||.|:| ..:..:.|..:.|..|:::|::|.....|:||.|||||||
Zfish   202 KEARQTIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPDIVEQMGCKHVKGILLFGPPGCGK 266

  Fly   710 TLLAKAI-----ANEAGINFISVKGPELMNMYVGESERAVRACFQRAR--------NSAPCVIFF 761
            ||:|:.|     |.|..|    |.|||::|.||||||..:|..|..|.        ||...:|.|
Zfish   267 TLMARQIGKMLNAREPKI----VNGPEILNKYVGESEANIRKLFADAEEEQKRLGANSGLHIIIF 327

  Fly   762 DEFDSLCPKRSDGGDGNNSGTRIVNQLLTEMDGVEERKGVYILAATNRPDIIDPAILRPGRLDTI 826
            ||.|::|.:|..|.........:|||||:::||||:...:.::..|||||:||.|::||||.:..
Zfish   328 DELDAICKQRGTGASSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALMRPGRFEVK 392

  Fly   827 LYVGFPEQSERTEILKA-TTKNGKRPVLADDVDLDEIAAQTEGYTGADLAGLVKQASMFSLRQSL 890
            :.:|.|::..|.:||.. |.|..:..:||.|||:.|:||:|:.|:||:|.|||:.|...::.:.:
Zfish   393 MEIGLPDEKGRVQILNIHTAKMREFKLLASDVDVKELAAETKNYSGAELEGLVRAAQSTAMNRHI 457

  Fly   891 NNGDT------NLDDLCVRSQHFQEAL-QQLRPS--VNEQDRKIY 926
            ....|      ..:.|.|....|..:| ..::|:  .|::|...|
Zfish   458 KATSTVEVDMERAEKLQVTRTDFMASLNNDIKPAFGTNQEDYSSY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 104/296 (35%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 17/36 (47%)
AAA 699..830 CDD:278434 61/143 (43%)
nsfaXP_021325418.1 CDC48_N 6..83 CDD:215012
CDC48_2 111..183 CDD:215011
TIP49 160..>606 CDD:332389 107/305 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.