DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and CG4701

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_609721.1 Gene:CG4701 / 34858 FlyBaseID:FBgn0028868 Length:384 Species:Drosophila melanogaster


Alignment Length:264 Identity:99/264 - (37%)
Similarity:148/264 - (56%) Gaps:19/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   658 DTTWDDIGALEKIREELKLAVLAPVKYPEMLERLGL-TAPSGVLLCGPPGCGKTLLAKAIANEAG 721
            |.:|.||..|:...:||:..|:.||::.::..|..| .||.||||.|||||||||:|||||.:||
  Fly    91 DISWSDIAGLDGTIQELRETVVLPVRHRKLFSRSKLWRAPKGVLLHGPPGCGKTLIAKAIAKDAG 155

  Fly   722 INFISVKGPELMNMYVGESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGDGNNSGTRIVN 786
            :.||::....|.:.:.|||::...|.|..|:...||:||.||.:|..  |..|.:.:.:...|..
  Fly   156 MRFINLDVGVLTDKWYGESQKLATAVFTLAKKLQPCIIFIDEIESFL--RMRGSNDHEATAMIKT 218

  Fly   787 QLLTEMDGVEERKG--VYILAATNRPDIIDPAILRPGRLDTILYVGFPEQSERTEILKATTKNGK 849
            |.:.:.||:.....  |.:|.|||||..:|.||||  |:....::|.|...:|.|||:...:..:
  Fly   219 QFMLQWDGLMSNTNICVLVLGATNRPQDLDKAILR--RMPAQFHIGVPRDCQRREILQLILQTEQ 281

  Fly   850 RPVLADDVDLDEIAAQTEGYTGADLAGLVKQASMFSLRQ----SLNNGD----TNLD-DLCVRSQ 905
               |:..|:|.|:|..|.|::|:||..|.:.|||:.:||    .||.|:    ..:: |..|:.|
  Fly   282 ---LSPSVNLKELARLTIGFSGSDLRELCRHASMYRMRQFMREKLNTGEEIGKDKIEWDFEVKDQ 343

  Fly   906 HFQE 909
            ..||
  Fly   344 ALQE 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 99/264 (38%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 21/37 (57%)
AAA 699..830 CDD:278434 54/132 (41%)
CG4701NP_609721.1 Parvo_NS1 47..>152 CDD:305166 31/60 (52%)
AAA 130..265 CDD:214640 57/138 (41%)
AAA 133..265 CDD:278434 55/135 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.