DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and si:dkey-195m11.8

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:XP_003198869.1 Gene:si:dkey-195m11.8 / 324372 ZFINID:ZDB-GENE-030131-3092 Length:269 Species:Danio rerio


Alignment Length:142 Identity:35/142 - (24%)
Similarity:55/142 - (38%) Gaps:28/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ETYLDVKQMTRELMQKYPEYSRRKFGPFRQLVHQAFSIISESYNLDKVSSSEEDCVSEDSEPPPT 91
            |.:.||...|...:...|.       ||.|....|||    .|:.|..:.|....:...:|....
Zfish    10 EQHYDVSSTTSPPVHPKPL-------PFPQPSRPAFS----GYSDDISALSASSLLKRYAERYSF 63

  Fly    92 NSVMNNMMNSLYS-QPRKPLAPKPIS-------EPIDISSGDENEDDSNTKTTNGDGVAAAAA-- 146
            ||.:....:.|.| ||::|. |...|       :|:..|..|.:|...::..|. |..::.::  
Zfish    64 NSALPEHGSFLRSEQPQEPW-PGGYSTEGPAGLDPLKASGSDLSEPQYSSAPTQ-DYPSSYSSQH 126

  Fly   147 --PPP---PTPA 153
              |.|   |:||
Zfish   127 LLPKPSYLPSPA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330 12/43 (28%)
SpoVK 271..919 CDD:223540
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359
AAA 699..830 CDD:278434
si:dkey-195m11.8XP_003198869.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.