DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and ruvbl1

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_776196.3 Gene:ruvbl1 / 317679 ZFINID:ZDB-GENE-030109-2 Length:456 Species:Danio rerio


Alignment Length:256 Identity:64/256 - (25%)
Similarity:97/256 - (37%) Gaps:61/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 APSGVLLCGPPGCGKTLLAKAIANEAG--INFISVKGPELMNMYVGESERAVRACFQRA---RNS 754
            |...:||.||||.|||.||.|:|.|.|  :.|..:.|.|:.:..:.::| .:...|:||   |..
Zfish    62 AGRAILLAGPPGTGKTALALAMAQELGNKVPFCPMVGSEVYSSEIKKTE-VLMENFRRAIGLRIK 125

  Fly   755 APCVIFFDEFDSLCPKRSD---GGDGNNSGTRIVNQLLTEMDGVEERKGVYILAATNRPDIIDPA 816
            ....::..|...|.|..::   ||.|......|:        |::..||...|            
Zfish   126 ETKEVYEGEVTELTPCETENPMGGYGKTISHVII--------GLKTAKGTKQL------------ 170

  Fly   817 ILRPGRLDTILYVGFPEQSERTEI---------LKATTKNGKRPVLADDVDLDEIAAQTEGYTGA 872
                 :||..:|...  |.||.|:         ..|..:.|:....|.:.||     :.|.|...
Zfish   171 -----KLDPSIYESL--QKERVEVGDVIYIEANSGAVKRQGRCDTFATEFDL-----EAEEYVPL 223

  Fly   873 DLAGLVKQASMFSLRQSLNNGDTNLDDLCV---RSQHFQEALQQLRPSVNEQDRKIYDKLR 930
            ....:.|:..:..        |..|.||.|   |.|..|:.|..:...:..:..:|.||||
Zfish   224 PKGDVHKKKEIIQ--------DVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 59/243 (24%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 12/20 (60%)
AAA 699..830 CDD:278434 37/138 (27%)
ruvbl1NP_776196.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
TIP49 14..416 CDD:283678 64/256 (25%)
P-loop_NTPase 40..>80 CDD:304359 10/17 (59%)
P-loop_NTPase 66..>119 CDD:304359 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.