DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and Ruvbl2

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:XP_038960960.1 Gene:Ruvbl2 / 292907 RGDID:1306509 Length:495 Species:Rattus norvegicus


Alignment Length:444 Identity:97/444 - (21%)
Similarity:154/444 - (34%) Gaps:159/444 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KTTNGDGVAAAAAPPPPTPAVQGSAL--------------------KRLME-------EVPEIAV 171
            ||....|:|.|..|..|..|:.||.:                    .|:.|       ||.||.:
  Rat    86 KTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQI 150

  Fly   172 ------AAKKVAKPNTIHVSSSEAIQKLHQVVGNR-AKNLSEDAVPRSKDHRNVPGLYQQLHQNQ 229
                  ...||.| .|:..:..|.|..|    |.: .::|::|.|                   |
  Rat   151 DRPATGTGSKVGK-LTLKTTEMETIYDL----GTKMIESLTKDKV-------------------Q 191

  Fly   230 SRDRLRKFKRDLEVQHPTESF---RDIGGMDSTLKELCEMLIHIKSPEFYFQLGLLPSRGLLLHG 291
            :.|.:...|...::.....||   ||...|.|..|       .::.|:     |.|..|..::| 
  Rat   192 AGDVITIDKATGKISKLGRSFTRARDYDAMGSQTK-------FVQCPD-----GELQKRKEVVH- 243

  Fly   292 PPGCGKTFLARAISGQLKMPLMEIPATE--------LIGGISGESEERIREVFDQAIG------- 341
                             .:.|.||....        |..|.:||.:..:||..:..:.       
  Rat   244 -----------------TVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGK 291

  Fly   342 --YSPCVLFIDEIDAIGGNRQWASKDMERRIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDP 404
              ..|.||||||:..:         |:|.      .|.|:  :|.|...:.|:|.||.|      
  Rat   292 AEIIPGVLFIDEVHML---------DIES------FSFLN--RALESDMAPVLIMATNR------ 333

  Fly   405 GLRRIGRFDHEIAIHIP---------------SRKERREILRIQCEGLSVDPKLNYDKIAELTPG 454
            |:.||....::....||               |.|:.::||||:||  ..|.:::.|....||  
  Rat   334 GITRIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCE--EEDVEMSEDAYTVLT-- 394

  Fly   455 YVGAD-----LMALVSRAASVAVKRRSMKKFRELHAASEKNMTTVTLDDDEPSE 503
            .:|.:     .:.|::.|:.|..||    |..|:.....|.:.::.||:...::
  Rat   395 RIGLETSLRYAIQLITAASLVCRKR----KGTEVQVDDIKRVYSLFLDESRSTQ 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 60/270 (22%)
AAA 287..418 CDD:278434 31/147 (21%)
P-loop_NTPase 679..>716 CDD:304359
AAA 699..830 CDD:278434
Ruvbl2XP_038960960.1 TIP49 18..454 CDD:224145 97/444 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.