DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and Trip13

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_001011930.1 Gene:Trip13 / 292206 RGDID:1308516 Length:432 Species:Rattus norvegicus


Alignment Length:273 Identity:68/273 - (24%)
Similarity:115/273 - (42%) Gaps:50/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 PSAKREGFITVPDTTWDDIGALEKIREELKLAVLAPVKYPEM-LERLGLTAPSGVLLCGPPGCGK 709
            |:|:..|.       ||.:....:::..|...|:..:.:.:. ::...:|....|||.||||.||
  Rat   128 PAAEFHGL-------WDSLVYDVEVKSHLLDYVMTTLLFSDKNVDSNLITWNRVVLLHGPPGTGK 185

  Fly   710 TLLAKAIANEAGI---------NFISVKGPELMNMYVGESERAVRACFQRARN-----SAPCVIF 760
            |.|.||:|.:..|         ..|.:....|.:.:..||.:.|...||:.::     .|...:.
  Rat   186 TSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLIDDKEALVFVL 250

  Fly   761 FDEFDSLCPKRS--DGGDGNNSGTRIVNQLLTEMDGVEERKGVYILAATNRPDIIDPAILRPGRL 823
            .||.:||...|:  ..|...:...|:||.:||::|.::....|.||..:|..:.||.|.:  .|.
  Rat   251 IDEVESLTAARNACRAGAEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSNITEKIDVAFV--DRA 313

  Fly   824 DTILYVGFPEQ--------SERTEILKATTKNGKRPVLA-----------DDVD-----LDEIAA 864
            |...|:|.|..        |...|::|......::.:|.           ::|.     |.||:.
  Rat   314 DIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIGFIENNVSKLSLLLSEISR 378

  Fly   865 QTEGYTGADLAGL 877
            ::||.:|..|..|
  Rat   379 KSEGLSGRVLRKL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 68/273 (25%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 13/37 (35%)
AAA 699..830 CDD:278434 45/146 (31%)
Trip13NP_001011930.1 RecA-like_Pch2-like 121..319 CDD:410916 52/199 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.