DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and AgaP_AGAP001522

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:XP_321602.5 Gene:AgaP_AGAP001522 / 1281656 VectorBaseID:AGAP001522 Length:445 Species:Anopheles gambiae


Alignment Length:279 Identity:70/279 - (25%)
Similarity:113/279 - (40%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 WDDIGALEKIREE-LKLAVLAPVKYPEMLERLG-----LTAPSGVLLCGPPGCGKTLLAKAIANE 719
            |:.:     |.|| :|.:|||..:...:..|.|     :|.....|..||||.|||.|.||||.:
Mosquito   114 WESL-----IYEEGIKDSVLAFAETSMLFARKGVDKNLITCNRLALFHGPPGTGKTSLCKAIAQK 173

  Fly   720 AGI---------NFISVKGPELMNMYVGESERAVRACFQRA------RNSAPCVIFFDEFDSLCP 769
            ..|         :.:.:....|.:.:..||.:.|:..|...      ..|..||: .||.:|:..
Mosquito   174 LSIRLNEQYRHAHLVEINSHSLFSRWFSESGKLVQKVFSEIVALLEDERSLVCVL-VDEIESIAY 237

  Fly   770 KRSDGGDGNNSGT-RIVNQLLTEMDGVEERKGVYILAATNRPDIIDPAILRPGRLDTILYVGFPE 833
            .|........|.: |:||.:||::|.:.....|:|||.:|..|.||.|.|  .|.|.:.|:..|.
Mosquito   238 ARDRISSNEPSDSIRVVNAVLTQLDRLRRFPNVFILATSNLTDSIDAAFL--DRADFVQYIDHPT 300

  Fly   834 QSERTEILKATTKNGKRPVLADDVDLDEIAAQTEGYTGADLAGLVKQASMFSLRQSLNNGDTNLD 898
            :....:|.::...|                .||        .|:|::.:..|.|:.........|
Mosquito   301 EPAIYDIYRSALYN----------------LQT--------IGIVEKEANTSNRRLSQTAANTTD 341

  Fly   899 DLCVRSQHFQEALQQLRPS 917
            .:    ..:::|:...:||
Mosquito   342 GI----PSYEQAIDPAKPS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 70/279 (25%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 15/41 (37%)
AAA 699..830 CDD:278434 46/146 (32%)
AgaP_AGAP001522XP_321602.5 AAA 154..300 CDD:214640 46/148 (31%)
AAA 154..297 CDD:278434 46/145 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.