DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and AgaP_AGAP004266

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:XP_313188.3 Gene:AgaP_AGAP004266 / 1274111 VectorBaseID:AGAP004266 Length:424 Species:Anopheles gambiae


Alignment Length:287 Identity:71/287 - (24%)
Similarity:123/287 - (42%) Gaps:63/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 HPTESFRDIGG--MDSTLKE--LCEMLIHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAIS 305
            ||.:. |.||.  :|..:.|  |.:....||:|::|...|:...||.||||||||||:....|::
Mosquito   182 HPRKR-RPIGSVVLDEGVSERILRDCREFIKNPQWYSDRGIPYRRGYLLHGPPGCGKSSFITALA 245

  Fly   306 GQLKMPLMEIPATELIGGISGESEERIREVFDQAIGYSPCVLFIDEIDAIGGNRQ------WASK 364
            |:::..:..:..:|     .|.:::|:..:.:.|...|  ::.:::|||...:||      .|.:
Mosquito   246 GEIEFGICLLNLSE-----RGLTDDRLNHLMNVAPQQS--IILLEDIDAAFVSRQDTLQQKAAYE 303

  Fly   365 DMERRIVSQLISSLDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREI 429
            .:.|...|.|::.||.:.:.|   :.:|...|...:.|||.|.|.||.|.:..:...||.:..::
Mosquito   304 GLNRVTFSGLLNCLDGVASTE---ARIVFMTTNYLERLDPALIRPGRVDVKEYVGHCSRHQLEQM 365

  Fly   430 LRIQCEGLSVDPKLNYDKIAELTPGYVGADLMALVSRAASVAVKRRSMKKFRELHAASEKNMTTV 494
            .|                     ..|.|.|..|             :.:.|.|..||..:|::  
Mosquito   366 FR---------------------RFYTGTDAEA-------------NARIFAERVAADGRNVS-- 394

  Fly   495 TLDDDEPSEDAGETPVPDSKGEETAKD 521
                  |::..|...|.....::|..|
Mosquito   395 ------PAQVQGYFMVHKMSDQQTVLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 62/257 (24%)
AAA 287..418 CDD:278434 39/136 (29%)
P-loop_NTPase 679..>716 CDD:304359
AAA 699..830 CDD:278434
AgaP_AGAP004266XP_313188.3 BCS1_N 23..192 CDD:214980 5/10 (50%)
AAA 224..355 CDD:214640 41/140 (29%)
AAA 227..355 CDD:278434 39/137 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.