DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and AgaP_AGAP003215

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:XP_312923.4 Gene:AgaP_AGAP003215 / 1273890 VectorBaseID:AGAP003215 Length:438 Species:Anopheles gambiae


Alignment Length:416 Identity:124/416 - (29%)
Similarity:203/416 - (48%) Gaps:76/416 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 GDKETSAKDKSEGDSPNIET-----PKKATNGNSSIKSPQKTPKK-------SAEKPTD-AAMDV 581
            |||:.. |||.:...|.|.|     .:||...::::|.||.||..       ..|:..| ..|:.
Mosquito    11 GDKDKD-KDKKKKYEPPIPTRVGKKKRKAKGPDAALKLPQVTPHTRCRLKLLKLERIKDYLLMEE 74

  Fly   582 DNVAPEEPKKAVEQEVDSSSSNDEYYEPTLAELTNFLDNPP-----EEFADPNFCL--------- 632
            :.:..:|..|..|::::...|          ::.:...:|.     ||..|.|..:         
Mosquito    75 EFIRNQERLKPQEEKIEEERS----------KVDDLRGSPMSVGTLEEIIDDNHAIVSTSVGSEH 129

  Fly   633 --TLIDFVDAIKVMQPSAK-----------------REGFITV------PDTTWDDIGALEKIRE 672
              :::.|||..: ::|...                 .:..:||      |..|:.|||.|:...:
Mosquito   130 YVSILSFVDKDQ-LEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQETYADIGGLDTQIQ 193

  Fly   673 ELKLAVLAPVKYPEMLERLGLTAPSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMNMYV 737
            |:|.:|..|:.:||..|.:|:..|.||:|.||||.||||||||:||:....|:.|.|.||:..|:
Mosquito   194 EIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYL 258

  Fly   738 GESERAVRACFQRARNSAPCVIFFDEFDSLCPKRSDGGDGNNSG-----TRIVNQLLTEMDGVEE 797
            |:..:.||..|:.|...||.::|.||.|::..||.|    :|||     .|.:.:||.::||.:.
Mosquito   259 GDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYD----SNSGGEREIQRTMLELLNQLDGFDS 319

  Fly   798 RKGVYILAATNRPDIIDPAILRPGRLDTILYVGFPEQSERTEILKATTKNGKRPVLADDVDLDEI 862
            |..|.::.||||.:.:|||::||||:|..:....|::..:..|....|   .|..||:||:|.|:
Mosquito   320 RGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFNIHT---ARMTLAEDVNLSEL 381

  Fly   863 AAQTEGYTGADLAGLVKQASMFSLRQ 888
            ....:..:|||:..:..:|.:.:||:
Mosquito   382 IMAKDDLSGADIKAICTEAGLMALRE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 124/416 (30%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 20/36 (56%)
AAA 699..830 CDD:278434 58/135 (43%)
AgaP_AGAP003215XP_312923.4 PTZ00361 1..438 CDD:185575 124/416 (30%)
Prot_ATP_ID_OB 106..>174 CDD:293059 10/68 (15%)
AAA 220..353 CDD:278434 58/136 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.