DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and AgaP_AGAP012537

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:XP_307605.4 Gene:AgaP_AGAP012537 / 1269024 VectorBaseID:AGAP012537 Length:175 Species:Anopheles gambiae


Alignment Length:174 Identity:34/174 - (19%)
Similarity:75/174 - (43%) Gaps:22/174 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 LIGGISGESEERIREVFDQAIGYSPCVLFIDEID------AIGGNRQWASKDMERRIVSQLISSL 378
            ::|...|....:||:.||.|...:...:.:|.|:      .||  .::::..::..:|  |:.  
Mosquito     1 MVGFSEGAKCLQIRKYFDDAYRSTFSCILVDNIERLLDYGPIG--PRYSNLTLQALLV--LLK-- 59

  Fly   379 DNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFDHEIAIHIPSRKERREILRIQCEGLSVDPKL 443
               |:...|:.::::..|:|..||: .:..:..|  ...:|:|:......::.:..:...|..:.
Mosquito    60 ---KSPPKGKKLLILCTTSRRQVLE-DMEMLSAF--TAVLHVPNLSTADHLIAVLEQEPDVFGRN 118

  Fly   444 NYDKIAELTPG---YVG-ADLMALVSRAASVAVKRRSMKKFREL 483
            ....|.:...|   :|| ..|:.|:..|..:..:.|.||...:|
Mosquito   119 ELAAIYKRLKGRRIFVGIKKLLDLIDLARQMDPQTRMMKFLSKL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 34/174 (20%)
AAA 287..418 CDD:278434 20/103 (19%)
P-loop_NTPase 679..>716 CDD:304359
AAA 699..830 CDD:278434
AgaP_AGAP012537XP_307605.4 AAA <3..97 CDD:214640 21/105 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.