DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and AKIRIN1

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_078871.1 Gene:AKIRIN1 / 79647 HGNCID:25744 Length:192 Species:Homo sapiens


Alignment Length:208 Identity:76/208 - (36%)
Similarity:113/208 - (54%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC-ATLKRALDWESMNQRP--PKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKD 62
            ||| |||||.:::|:....|  ||||||.|.  .|...|...|..:.|      |...:....:.
Human     1 MACGATLKRPMEFEAALLSPGSPKRRRCAPL--PGPTPGLRPPDAEPP------PPFQTQTPPQS 57

  Fly    63 STEPS-PFSESSLAKMSPDKMAESLCNEIKRLHKRKQLPITSSALERMQDSESSGSEMGPESP-- 124
            ..:|: |.||..|.  :|:::.:::..|..|..:.:.|.:.      :..||:..||..|.|.  
Human    58 LQQPAPPGSERRLP--TPEQIFQNIKQEYSRYQRWRHLEVV------LNQSEACASESQPHSSAL 114

  Fly   125 RRPDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYDQI 189
            ..|.||.:.....::..||.:||.:|||.::|:.|:::||.||.:|.|||||||::|||||:|||
Human   115 TAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQI 179

  Fly   190 QRRYEAAP-SYLS 201
            .|||...| ||:|
Human   180 MRRYGTRPTSYVS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 74/205 (36%)
AKIRIN1NP_078871.1 akirin-1 2..192 CDD:412035 74/205 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..71 17/61 (28%)
Nuclear localization signal 23..28 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..127 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145950
Domainoid 1 1.000 129 1.000 Domainoid score I5263
eggNOG 1 0.900 - - E1_KOG4330
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4665
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420469at2759
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - otm41890
orthoMCL 1 0.900 - - OOG6_105453
Panther 1 1.100 - - O PTHR13293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4225
SonicParanoid 1 1.000 - - X2925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.