DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and Akirin1

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001025225.1 Gene:Akirin1 / 595134 RGDID:1585989 Length:191 Species:Rattus norvegicus


Alignment Length:207 Identity:76/207 - (36%)
Similarity:114/207 - (55%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC-ATLKRALDWESMNQRP--PKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKD 62
            ||| |||||.:::|:....|  ||||||.|.  .|...|...|..:.|......|  |::     
  Rat     1 MACGATLKRPMEFEAALLSPGSPKRRRCAPL--PGPTPGLRPPDAEPPPFQMQTP--PAS----- 56

  Fly    63 STEPS-PFSESSLAKMSPDKMAESLCNEIKRLHKRKQLPITSSALER-MQDSESSGSEMGPESPR 125
            ..:|: |.||..|.  :|:::.:::..|..|..:.:.|.:..|..|. ..:|:|..|.:     .
  Rat    57 LQQPAPPGSERRLP--TPEQIFQNIKQEYNRYQRWRHLEVVLSQSEACTSESQSPSSAL-----T 114

  Fly   126 RPDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYDQIQ 190
            .|.||.......::..||.:||.:|||.::|:.|:::||.||.:|:|||||||::|||||:|||.
  Rat   115 APSSPGAFWMKKDQPTFTLRQVGIICERLLKDYEDKVREEYEQILSTKLAEQYESFVKFTHDQIM 179

  Fly   191 RRYEAAP-SYLS 201
            |||...| ||:|
  Rat   180 RRYGTRPTSYVS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 74/204 (36%)
Akirin1NP_001025225.1 akirin 2..191 CDD:425410 74/204 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339673
Domainoid 1 1.000 130 1.000 Domainoid score I5080
eggNOG 1 0.900 - - E1_KOG4330
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4548
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420469at2759
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - otm46025
orthoMCL 1 0.900 - - OOG6_105453
Panther 1 1.100 - - O PTHR13293
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2925
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.