DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and AKIRIN2

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_060534.1 Gene:AKIRIN2 / 55122 HGNCID:21407 Length:203 Species:Homo sapiens


Alignment Length:207 Identity:83/207 - (40%)
Similarity:121/207 - (58%) Gaps:10/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC-ATLKRALDWES-MNQRPPKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKDS 63
            ||| |||||.||::. ::...||||||.|.....|.|  |||.....:|:|......::......
Human     1 MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAA--ASPLSAAAATAASFSAAAASPQKYLR 63

  Fly    64 TEPSPFSESSLAKMSPDKMAESLCNEIKRLHKRKQLPITSSALERMQDSESSGSEM---GPESPR 125
            .|||||.:.| ::::.:::..::..|.||:.||:.|..:....:....|::.....   ||.||.
Human    64 MEPSPFGDVS-SRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPG 127

  Fly   126 RPDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYDQIQ 190
            ...:..:.::. |:.|||.:||.:|||.::||||.::||.||.:|.||||||||||||||:|||.
Human   128 TSSAASSPLKK-EQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIM 191

  Fly   191 RRYEAAP-SYLS 201
            |||...| ||:|
Human   192 RRYGEQPASYVS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 81/204 (40%)
AKIRIN2NP_060534.1 akirin-2 2..203 CDD:412036 81/204 (40%)
Nuclear localization signal 22..27 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145951
Domainoid 1 1.000 129 1.000 Domainoid score I5263
eggNOG 1 0.900 - - E1_KOG4330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9988
Inparanoid 1 1.050 129 1.000 Inparanoid score I4665
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48613
OrthoDB 1 1.010 - - D1420469at2759
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - otm41890
orthoMCL 1 0.900 - - OOG6_105453
Panther 1 1.100 - - LDO PTHR13293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4225
SonicParanoid 1 1.000 - - X2925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.