DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and akirin1

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001016080.1 Gene:akirin1 / 548834 XenbaseID:XB-GENE-5820002 Length:186 Species:Xenopus tropicalis


Alignment Length:206 Identity:76/206 - (36%)
Similarity:119/206 - (57%) Gaps:25/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC-ATLKRALDWES-MNQRPPKRRRCNPFGQAGSNAGPASPSRDG--PSTSAGLPHTPSNRFAK 61
            ||| |||||::::|: |:.:.||||||.|.  .||.|.| ||.|.|  |....| ...|..:...
 Frog     1 MACGATLKRSMEFEALMSPQSPKRRRCAPL--PGSPATP-SPQRCGIRPEMQQG-QQQPLLQLGG 61

  Fly    62 DSTEPSPFSESSLAKMSPDKMAESLCNEIKRLHKRKQLPITSSALERMQDSESSGSEMGPESPRR 126
            |            .:::|:::.:::..|..|..:|:||   ..|..:.:...|:..:....|...
 Frog    62 D------------RRLTPEQILQNIKQEYTRYQRRRQL---EGAFNQSEAGVSNEVQASCSSLTA 111

  Fly   127 PDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYDQIQR 191
            |.||.:|::. ::..|:.:||.::||.::|:.|:::||.||.:|..||||||::|||||:|||.|
 Frog   112 PSSPGSLVKK-DQPTFSLRQVGILCERLLKDHEDKIREEYEQILNIKLAEQYESFVKFTHDQIMR 175

  Fly   192 RYEAAP-SYLS 201
            ||.|.| ||:|
 Frog   176 RYGARPASYVS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 74/203 (36%)
akirin1NP_001016080.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64 29/78 (37%)
Nuclear localization signal 22..27 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5587
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4593
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420469at2759
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - otm49110
Panther 1 1.100 - - O PTHR13293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4225
SonicParanoid 1 1.000 - - X2925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.