DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and Akirin2

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001007590.2 Gene:Akirin2 / 433693 MGIID:1889364 Length:201 Species:Mus musculus


Alignment Length:210 Identity:83/210 - (39%)
Similarity:125/210 - (59%) Gaps:18/210 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC-ATLKRALDWES-MNQRPPKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKDS 63
            ||| |||||.||::. ::...||||||.|.....|.|  |||:....:.:|........::.:  
Mouse     1 MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPASAA--ASPAAATAAAAASAAAASPQKYLR-- 61

  Fly    64 TEPSPFSESSLAKMSPDKMAESLCNEIKRLHKRKQLPITSSALERMQDSESSGSE------MGPE 122
            .|||||.:.| ::::.:::..::..|.||:.||:.|   .::.::.....:|.|:      .||.
Mouse    62 MEPSPFGDVS-SRLTTEQILYNIKQEYKRMQKRRHL---EASFQQADPGCTSDSQPHAFLISGPA 122

  Fly   123 SPRRPDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYD 187
            ||....:..:.::. |:.|||.:||.:|||.::||||.::||.||.:|.||||||||||||||:|
Mouse   123 SPGTSSATSSPLKK-EQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHD 186

  Fly   188 QIQRRYEAAP-SYLS 201
            ||.|||...| ||:|
Mouse   187 QIMRRYGEQPASYVS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 81/207 (39%)
Akirin2NP_001007590.2 Nuclear localization signal 23..28 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836029
Domainoid 1 1.000 130 1.000 Domainoid score I5189
eggNOG 1 0.900 - - E1_KOG4330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9988
Inparanoid 1 1.050 130 1.000 Inparanoid score I4620
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48613
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - otm43937
orthoMCL 1 0.900 - - OOG6_105453
Panther 1 1.100 - - LDO PTHR13293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4225
SonicParanoid 1 1.000 - - X2925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.