DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and akirin2

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_998459.2 Gene:akirin2 / 406855 ZFINID:ZDB-GENE-040426-2944 Length:180 Species:Danio rerio


Alignment Length:215 Identity:85/215 - (39%)
Similarity:115/215 - (53%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC-ATLKRALDWES-MNQRPPKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKDS 63
            ||| |||||.:|::. ||...||||||.|...:.|:|.|....|                     
Zfish     1 MACGATLKRTMDFDPLMNPASPKRRRCAPMSPSSSSASPQKYLR--------------------- 44

  Fly    64 TEPSPFSESSLAKMSPDKMAESLCNEIKRLHKRKQL-----------PITSSALERMQDSESSGS 117
            .|||||...|.| ::.:::..::..|.||:.||:.|           |:.|   :....|.|:||
Zfish    45 MEPSPFGRVSSA-LTTEQILSNIKQEYKRMQKRRHLESSFQQTDSCCPLDS---QPHASSSSTGS 105

  Fly   118 EMGPESPRRPDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFV 182
            ..|..||.|.:.|          |||.:||.:|||.::||||.::||.|:.:|||||||||||||
Zfish   106 SSGSASPSRREQP----------LFTLRQVGMICERLLKEREEKVREEYDEILTTKLAEQYDAFV 160

  Fly   183 KFTYDQIQRRYEAAP-SYLS 201
            |||:||:.||:...| ||:|
Zfish   161 KFTHDQLMRRFGEQPASYVS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 83/212 (39%)
akirin2NP_998459.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579434
Domainoid 1 1.000 128 1.000 Domainoid score I5272
eggNOG 1 0.900 - - E1_KOG4330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9988
Inparanoid 1 1.050 128 1.000 Inparanoid score I4648
OMA 1 1.010 - - QHG48613
OrthoDB 1 1.010 - - D1420469at2759
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - otm24255
orthoMCL 1 0.900 - - OOG6_105453
Panther 1 1.100 - - LDO PTHR13293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4225
SonicParanoid 1 1.000 - - X2925
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.