DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and akirin1

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001107272.1 Gene:akirin1 / 406432 ZFINID:ZDB-GENE-040426-2178 Length:211 Species:Danio rerio


Alignment Length:226 Identity:78/226 - (34%)
Similarity:115/226 - (50%) Gaps:40/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC-ATLKRALDWES-MNQRPPKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKDS 63
            ||| |||||::::|: ::.:.||||||||.        |.:|:...|...:..|.|.|     .:
Zfish     1 MACGATLKRSMEFEALLSPQSPKRRRCNPL--------PGTPTTPSPQRCSLRPSTES-----PA 52

  Fly    64 TEPSPFSESSLAKMSPDKMA----------------------ESLCNEIKRLHKRKQLPITSSAL 106
            ...||.|.....:::||..|                      :::..|..|..:|:||....:..
Zfish    53 HSMSPQSMGGEHRLTPDMKALGILGNCLQQDGNVVQQIEQIFQNIRQEYSRYQRRRQLEGAFNQT 117

  Fly   107 ERMQDSESSGSEMGPESPRRPDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLT 171
            |....::...|.....||..|....:|.:  ::.|||.:||..:||.:||:.|.::||.||.:|.
Zfish   118 EPCSSTDIQSSSPALTSPSSPTGASSLKK--DQPLFTLRQVGYLCERLIKDHEEKMREEYEQILN 180

  Fly   172 TKLAEQYDAFVKFTYDQIQRRYEAAP-SYLS 201
            |||||||::|||||.|||.|||.|.| ||:|
Zfish   181 TKLAEQYESFVKFTQDQIMRRYGARPASYVS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 76/223 (34%)
akirin1NP_001107272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579433
Domainoid 1 1.000 128 1.000 Domainoid score I5272
eggNOG 1 0.900 - - E1_KOG4330
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420469at2759
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - otm24255
orthoMCL 1 0.900 - - OOG6_105453
Panther 1 1.100 - - O PTHR13293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4225
SonicParanoid 1 1.000 - - X2925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.