DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and akirin2

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_988914.1 Gene:akirin2 / 394510 XenbaseID:XB-GENE-951494 Length:181 Species:Xenopus tropicalis


Alignment Length:205 Identity:80/205 - (39%)
Similarity:111/205 - (54%) Gaps:28/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAC-ATLKRALDWESM--NQRPPKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKD 62
            ||| |||||.::::.:  ....||||||          .|.||  .|||....|           
 Frog     1 MACGATLKRTIEFDPLLSPAASPKRRRC----------APLSP--PGPSPQKYL----------- 42

  Fly    63 STEPSPFSESSLAKMSPDKMAESLCNEIKRLHKRKQLPITSSALERMQDSESSGSEMGPESPRRP 127
            ..|||||.|.| .:::.:::..::..|.||:.||:.|..:....:....||.......|..|..|
 Frog    43 RMEPSPFGEVS-PRLTAEQILYNIKQEYKRMQKRRHLEASFQPTDPCCSSEGQPQTFIPSGPTLP 106

  Fly   128 DSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYDQIQRR 192
            .:........|:.||:.:||.:|||.::||||:::||.||.:||||||||||||||||:|||.||
 Frog   107 GTSATSPLRKEQPLFSLRQVGMICERLLKEREDKVREEYEEILTTKLAEQYDAFVKFTHDQIMRR 171

  Fly   193 YEAAP-SYLS 201
            :...| ||:|
 Frog   172 FGEQPASYVS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 78/202 (39%)
akirin2NP_988914.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5587
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9988
Inparanoid 1 1.050 122 1.000 Inparanoid score I4593
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420469at2759
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - otm49110
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2925
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.