DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment akirin and akir-1

DIOPT Version :9

Sequence 1:NP_001189058.1 Gene:akirin / 38821 FlyBaseID:FBgn0082598 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_491304.1 Gene:akir-1 / 171997 WormBaseID:WBGene00017088 Length:218 Species:Caenorhabditis elegans


Alignment Length:238 Identity:71/238 - (29%)
Similarity:110/238 - (46%) Gaps:57/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACA-TLKRAL--DWESM-------NQRPPKRRRCNPF-GQAGSNAGPASPSRDGPSTSAGLPHT 54
            |||. .|||.|  ::||.       .:....|.:|.|| .|.|:.|...      ||||     |
 Worm     1 MACGLALKRPLQHEYESFLTDETYNGEAKRARTQCPPFRAQMGTIAATL------PSTS-----T 54

  Fly    55 PSNRFAKDSTEPSPFSESSL-AKMSPDKMAESLCNEIKRLHKRKQLPITSSALERMQDSESSGSE 118
            .:.:|.:.  |.|.|..::| .::|.:::...|.:|:|.|.|||.:|       |..|.:..|.:
 Worm    55 FAQKFKEQ--EESVFQAATLMTRLSRNQLKTYLSSEVKNLRKRKAIP-------RSNDFDDDGDQ 110

  Fly   119 MG-------PESPRRPDSPQN-------------LMRHGEKALFTFKQVQLICESMIKERENQLR 163
            .|       .::.|.|.||::             ..|...|..||...||:|||.::|::|.:||
 Worm   111 RGDGCSSNYSKAYRAPSSPKSGSDSEGEAPSTSVTDRSSAKREFTMANVQMICERLLKQQEIRLR 175

  Fly   164 ERYESVLTTKLAEQYDAFVKFTYDQIQRRY-----EAAPSYLS 201
            ..:|.|||.||.||:..:|:|..:|:..:.     :.:.||||
 Worm   176 NEFEMVLTKKLDEQHQQYVQFAAEQLNSKCVSTGDDYSYSYLS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
akirinNP_001189058.1 akirin 2..201 CDD:425410 68/235 (29%)
akir-1NP_491304.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157541
Domainoid 1 1.000 70 1.000 Domainoid score I6223
eggNOG 1 0.900 - - E1_KOG4330
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3901
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48613
OrthoDB 1 1.010 - - D1420469at2759
OrthoFinder 1 1.000 - - FOG0003080
OrthoInspector 1 1.000 - - oto19428
orthoMCL 1 0.900 - - OOG6_105453
Panther 1 1.100 - - LDO PTHR13293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4225
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.