DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and SH3BGRL2

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_113657.1 Gene:SH3BGRL2 / 83699 HGNCID:15567 Length:107 Species:Homo sapiens


Alignment Length:105 Identity:41/105 - (39%)
Similarity:63/105 - (60%) Gaps:6/105 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDP 65
            ||::|:::..||...:||:||.|:..|::..|:::.||||.  .|.:::.|.    .|......|
Human     1 MVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITM--SEEQRQWMY----KNVPPEKKP 59

  Fly    66 EPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAP 105
            ...:|||||:||.|.||||||:|..:.|.:|:..||.|.|
Human    60 TQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 39/102 (38%)
SH3BGRL2NP_113657.1 GRX_SH3BGR 2..97 CDD:239328 38/100 (38%)
SH3-binding. /evidence=ECO:0000255 61..67 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9070
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm41971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.