DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and SH3BGRL3

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_112576.1 Gene:SH3BGRL3 / 83442 HGNCID:15568 Length:93 Species:Homo sapiens


Alignment Length:105 Identity:41/105 - (39%)
Similarity:61/105 - (58%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPG--KESEKELMQN-KSTSNGGTVSD 64
            |:||.:.::|::|:|.:|..|..|||.|.|:|..|||::..  ::..:.|..| |:|        
Human     4 LRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKAT-------- 60

  Fly    65 PEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLA 104
                   |||:.|.|:|||||:.|..|.|.:||:.|||||
Human    61 -------PPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 39/103 (38%)
SH3BGRL3NP_112576.1 SH3BGR 2..93 CDD:398530 39/103 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4602
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12232
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.