DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and SH3BGRL3

DIOPT Version :10

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_112576.1 Gene:SH3BGRL3 / 83442 HGNCID:15568 Length:93 Species:Homo sapiens


Alignment Length:105 Identity:41/105 - (39%)
Similarity:61/105 - (58%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPG--KESEKELMQN-KSTSNGGTVSD 64
            |:||.:.::|::|:|.:|..|..|||.|.|:|..|||::..  ::..:.|..| |:|        
Human     4 LRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKAT-------- 60

  Fly    65 PEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLA 104
                   |||:.|.|:|||||:.|..|.|.:||:.|||||
Human    61 -------PPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 1..104 CDD:469754 39/103 (38%)
2A1904 <138..392 CDD:273344
SH3BGRL3NP_112576.1 SH3BGR 2..93 CDD:398530 39/103 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.