DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and AT5G06470

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_196265.1 Gene:AT5G06470 / 830535 AraportID:AT5G06470 Length:239 Species:Arabidopsis thaliana


Alignment Length:195 Identity:39/195 - (20%)
Similarity:65/195 - (33%) Gaps:68/195 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEK--ELMQNKSTSNGGTVSDPEPR 68
            |.:|:...::..:..:||..:|::..:.|...|::...:..|:  .|:..|.||           
plant    94 YTTGLRSVRKTFEACRRVRFLLENHQVMYRERDVSMDSEFREEMWRLLGGKVTS----------- 147

  Fly    69 HPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAPADTTAVSTAQIELKQENGDAKKEEAETE 133
                |:||....|.|.      |.|:..|                      .|||..        
plant   148 ----PRLFIRGRYIGG------AEEVVAL----------------------NENGKL-------- 172

  Fly   134 AEDKKTEAGDGDVDVKEEAAEKAENE--------DGKDKENSKGEDEDADEENAEQK-TETEESG 189
               ||...|...||   ...|..|||        :|..:..::..||::..:|...: .|..|:|
plant   173 ---KKLLQGISQVD---SPCESCENERFLICSSCNGSTRLLAEHHDEESSNDNMWTRCRECNENG 231

  Fly   190  189
            plant   232  231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 20/99 (20%)
AT5G06470NP_196265.1 GRX_GRX_like 90..235 CDD:239329 39/195 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.