DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and zgc:153284

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001278865.1 Gene:zgc:153284 / 751696 ZFINID:ZDB-GENE-060825-317 Length:120 Species:Danio rerio


Alignment Length:89 Identity:39/89 - (43%)
Similarity:48/89 - (53%) Gaps:12/89 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDPEPRHPLPPQLFNDD 79
            :||:.|..:|..||||.|||.||||:.  ....||.|:.|       |.:|.   .:|||:||.|
Zfish    44 QVKQHQGEILGFLDSKKIKYFTVDIST--SNDAKEQMRKK-------VGNPS---AMPPQVFNGD 96

  Fly    80 EYCGDYDAFDMANEIDTLEVFLKL 103
            :|||||..|..|.|....|.|.||
Zfish    97 KYCGDYQKFFDAVEEGKPEAFFKL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 39/89 (44%)
zgc:153284NP_001278865.1 GRX_SH3BGR 45..120 CDD:239328 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm26267
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12232
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.