DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and Sh3bgrl3

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_542126.1 Gene:Sh3bgrl3 / 73723 MGIID:1920973 Length:93 Species:Mus musculus


Alignment Length:105 Identity:41/105 - (39%)
Similarity:60/105 - (57%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPG--KESEKELMQN-KSTSNGGTVSD 64
            |:||.:.::|::|:|.:|..|..|||.|.|:|..|||::..  ::..:.|..| |:|        
Mouse     4 LRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKAT-------- 60

  Fly    65 PEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLA 104
                   |||:.|.:.|||||:.|..|.|.|||:.|||||
Mouse    61 -------PPQIVNGNHYCGDYELFVEAVEQDTLQEFLKLA 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 39/103 (38%)
Sh3bgrl3NP_542126.1 SH3BGR 2..93 CDD:398530 39/103 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4602
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12232
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.