powered by:
Protein Alignment Sh3beta and Get1
DIOPT Version :9
Sequence 1: | NP_001189057.1 |
Gene: | Sh3beta / 38820 |
FlyBaseID: | FBgn0035772 |
Length: | 485 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_997184.1 |
Gene: | Get1 / 71446 |
MGIID: | 2136882 |
Length: | 174 |
Species: | Mus musculus |
Alignment Length: | 49 |
Identity: | 9/49 - (18%) |
Similarity: | 27/49 - (55%) |
Gaps: | 7/49 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 357 EESADSDSATKSEVKSTEDDEVVESEDVKDEFE-----ENETNKKVEEV 400
::.|:.:|..::|::..:.: :.:.::.|||. |.:.||..:::
Mouse 40 QKDAEQESQMRAEIQGMKQE--LSTVNMMDEFARYARLERKINKMTDKL 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1508713at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.