DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and Get1

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_997184.1 Gene:Get1 / 71446 MGIID:2136882 Length:174 Species:Mus musculus


Alignment Length:49 Identity:9/49 - (18%)
Similarity:27/49 - (55%) Gaps:7/49 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 EESADSDSATKSEVKSTEDDEVVESEDVKDEFE-----ENETNKKVEEV 400
            ::.|:.:|..::|::..:.:  :.:.::.|||.     |.:.||..:::
Mouse    40 QKDAEQESQMRAEIQGMKQE--LSTVNMMDEFARYARLERKINKMTDKL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274
Get1NP_997184.1 CHD5 17..163 CDD:309528 9/49 (18%)
Interaction with GET3/TRC40. /evidence=ECO:0000250 39..97 9/49 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.