DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and SH3BGRL

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_011529315.1 Gene:SH3BGRL / 6451 HGNCID:10823 Length:176 Species:Homo sapiens


Alignment Length:108 Identity:39/108 - (36%)
Similarity:60/108 - (55%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDPEPRHPLPPQLFNDD 79
            ::||:||.||..|::..|.::..||.  ..|..::.|:.....|    |.|...:|||||:||:.
Human    77 QIKKKQQDVLGFLEANKIGFEEKDIA--ANEENRKWMRENVPEN----SRPATGYPLPPQIFNES 135

  Fly    80 EYCGDYDAFDMANEIDTLEVFLKL-APADTTAVSTAQIELKQE 121
            :|.||||||..|.|.:.:..||.| ||..:   ..|:::.||:
Human   136 QYRGDYDAFFEARENNAVYAFLGLTAPPGS---KEAEVQAKQQ 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 34/89 (38%)
SH3BGRLXP_011529315.1 GRX_SH3BGR 78..159 CDD:239328 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9070
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm41971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.