DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and sh3bgrl2

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001016155.1 Gene:sh3bgrl2 / 548909 XenbaseID:XB-GENE-1015677 Length:106 Species:Xenopus tropicalis


Alignment Length:103 Identity:42/103 - (40%)
Similarity:66/103 - (64%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDP 65
            ||:||:::..|.:..:|||||.||..|::..|:|:.||||.  .|.:::.|......:    ..|
 Frog     1 MVIKVFLASSSSSVTIKKRQQEVLQFLEANRIEYEEVDITM--LEEKRQWMYKNIPKD----RLP 59

  Fly    66 EPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKL 103
            |..:|||||:|||:.|||||::|..:.|.:|:.:||:|
 Frog    60 EQGNPLPPQIFNDNIYCGDYESFFESKESNTVFLFLQL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 42/103 (41%)
sh3bgrl2NP_001016155.1 GRX_SH3BGR 2..97 CDD:239328 40/100 (40%)
SH3-binding. /evidence=ECO:0000255 61..67 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8472
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5053
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm49196
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.