DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and Sh3bgr

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_056640.1 Gene:Sh3bgr / 50795 MGIID:1354740 Length:214 Species:Mus musculus


Alignment Length:238 Identity:77/238 - (32%)
Similarity:126/238 - (52%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQ-----NKSTSNGG 60
            ||:||:|:..||:..::|:||.|:..|::..|.:..:||.  |.|..::.|:     .|...|| 
Mouse     1 MVIKVFVATSSGSIAIRKKQQEVVGFLEANKIDFKELDIA--GDEDNRKWMRENVPGEKKPQNG- 62

  Fly    61 TVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAPADTTAVSTAQIELKQENGD- 124
                    .|||||:||:::||||:|:|..|.|.:.:..||.|||...:.|:.::......||| 
Mouse    63 --------IPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPPPGSKVTKSEEASSLPNGDV 119

  Fly   125 AKKEEAETEAEDKKTEAGDGDVDVKEEAAEKAENEDGKDKENSKGEDEDADEENAEQKTETEESG 189
            |.:.|...|..:|..::|:.:.. ||::.:..|..:.::|:..:|||.:..||..|:    ||.|
Mouse   120 AGEAEGAAEGTEKAEKSGENEAQ-KEDSEDTGELSESQEKKEEEGEDGEEGEEGEER----EEGG 179

  Fly   190 DKKTEEKTTDAEGETQEKSEEVDTKEKSEVESTKDDEVGKSED 232
            :.:|       .|||:|..||....|..|.|  .::|.|:.||
Mouse   180 EGET-------TGETEEAPEEGAGGEAEEEE--PEEEAGEGED 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 38/107 (36%)
Sh3bgrNP_056640.1 SH3BGR 1..98 CDD:252868 38/107 (36%)
SH3-binding. /evidence=ECO:0000255 61..67 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..214 36/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9025
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5119
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm44021
orthoMCL 1 0.900 - - OOG6_110742
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 1 1.000 - - X4396
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.