DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and Sh3bgr

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006248246.1 Gene:Sh3bgr / 498066 RGDID:1563599 Length:204 Species:Rattus norvegicus


Alignment Length:247 Identity:80/247 - (32%)
Similarity:126/247 - (51%) Gaps:50/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQ-----NKSTSNGG 60
            ||:||:|:..||:..::|:||.|:..|::..|.:..:||.  |.|..::.|:     .|...|| 
  Rat     1 MVIKVFVATSSGSIAIRKKQQEVVGFLEANKIDFKELDIA--GDEDNRKWMRENVPGEKKPQNG- 62

  Fly    61 TVSDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAPADTTAVSTAQIELKQENGDA 125
                    .|||||:||:::||||:|:|..|.|.:.:..||.|||...:.|:             
  Rat    63 --------IPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPPPGSKVT------------- 106

  Fly   126 KKEEAETEAEDKKTEAGDGDVDVKEEAAEKAENEDGKDKENSKGEDEDADEENAEQKTETEESGD 190
            |.|||        :...:|||..:.|.|     .:|.:|....||.| |.:|::|...|..:|.:
  Rat   107 KSEEA--------SSLPNGDVAGEAEGA-----AEGTEKAEESGETE-AQKEDSEDTGELSQSQE 157

  Fly   191 KKTEEKTTDAEGETQEKSEEVDTKEKSEVESTKDDEVGKSEDVKDDEDEKSE 242
            ||.|      |||..||.||.:|.|::| |:|:....|::|:..::|..:.|
  Rat   158 KKEE------EGEEGEKGEEGETAEETE-EATEGGAEGEAEEEPEEEGGEEE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 38/107 (36%)
Sh3bgrXP_006248246.1 SH3BGR 1..98 CDD:252868 38/107 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9088
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5030
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm46113
orthoMCL 1 0.900 - - OOG6_110742
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4396
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.