DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and sh3bgrl2

DIOPT Version :10

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001002197.1 Gene:sh3bgrl2 / 431744 ZFINID:ZDB-GENE-040704-38 Length:105 Species:Danio rerio


Alignment Length:106 Identity:42/106 - (39%)
Similarity:65/106 - (61%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSD- 64
            ||::||::..||:..||||||.::..|::..|.::.||||.  .|.::..|..|       :.| 
Zfish     1 MVIRVYIASSSGSVAVKKRQQAIVGFLEANRISFEEVDITM--LEDQRLWMYQK-------IPDE 56

  Fly    65 --PEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKL 103
              ||..:|||||:||.::|||||:.|..:.|.:|:..||:|
Zfish    57 KRPEKGNPLPPQIFNGEDYCGDYEDFFQSKETNTVFSFLRL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 1..104 CDD:469754 42/106 (40%)
2A1904 <138..392 CDD:273344
sh3bgrl2NP_001002197.1 GRX_SH3BGR 2..97 CDD:239328 40/103 (39%)
SH3-binding. /evidence=ECO:0000255 61..67 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.