DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and sh3bgrl

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_957503.1 Gene:sh3bgrl / 394184 ZFINID:ZDB-GENE-040426-1376 Length:115 Species:Danio rerio


Alignment Length:130 Identity:46/130 - (35%)
Similarity:69/130 - (53%) Gaps:21/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSD- 64
            ||:|||::..||:..:||:||.|:..|....|.::..||. ..:|:.|.:.:|        |.| 
Zfish     1 MVIKVYIASSSGSTSIKKQQQDVMGFLTVNKIDFEECDIA-ADEENRKWMREN--------VPDD 56

  Fly    65 --PEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAPADTTAVSTAQIELKQENGDAKK 127
              |...:|||||:||:::|||:|:||..|.|.:.:..||.|         ||....|:....|||
Zfish    57 FRPATGNPLPPQIFNEEKYCGNYEAFFSAREDNAVYAFLGL---------TAPPGSKEAEALAKK 112

  Fly   128  127
            Zfish   113  112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 39/105 (37%)
sh3bgrlNP_957503.1 GRX_SH3BGR 2..97 CDD:239328 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8583
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5187
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm26267
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.