DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and RGD1562039

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_038956330.1 Gene:RGD1562039 / 367869 RGDID:1562039 Length:97 Species:Rattus norvegicus


Alignment Length:99 Identity:35/99 - (35%)
Similarity:57/99 - (57%) Gaps:12/99 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDPEPRH 69
            :|.:.:||::|:|:||:.|:.:||...|||:.:||.     ...|:::...|.    |:.|:   
  Rat     6 IYYASVSGSREIKQRQEEVMRVLDIYKIKYELIDIA-----VSTEVLEEMRTK----VASPK--- 58

  Fly    70 PLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKL 103
            .:|||:||..|||||:..|..|.|...:..|||:
  Rat    59 AIPPQIFNGQEYCGDFIRFHDAKENKEILKFLKM 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 35/99 (35%)
RGD1562039XP_038956330.1 GRX_SH3BGR 4..92 CDD:239328 34/97 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12232
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.