DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and Sh3bgrl

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001166810.1 Gene:Sh3bgrl / 302363 RGDID:1560520 Length:114 Species:Rattus norvegicus


Alignment Length:122 Identity:45/122 - (36%)
Similarity:69/122 - (56%) Gaps:10/122 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDP 65
            ||:.||::..||:..:||:||.||..|::..|.::..||. ..:|:.|.:.:|....     |.|
  Rat     1 MVIHVYIASSSGSTAIKKKQQDVLCFLEANKIGFEEKDIA-ANEENRKWMRENVPED-----SRP 59

  Fly    66 EPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKL-APADTTAVSTAQIELKQE 121
            ...:|||||:||:.:|.||||||..|.|.:.:..||.| ||..:   ..|:.:.||:
  Rat    60 PTGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGS---KEAEAQAKQQ 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 40/103 (39%)
Sh3bgrlNP_001166810.1 GRX_SH3BGR 2..97 CDD:239328 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9088
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5030
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm46113
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.