DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and Y105E8A.1

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001263593.1 Gene:Y105E8A.1 / 260216 WormBaseID:WBGene00013666 Length:212 Species:Caenorhabditis elegans


Alignment Length:246 Identity:87/246 - (35%)
Similarity:126/246 - (51%) Gaps:47/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNG--GTVSDP 65
            |||||:..:.|.|.|.|.||.|||||...|.:|::|||:|....::..|:..::..|  |.|   
 Worm     4 LKVYVASATANPETKYRVQRTLMILDGLGIPFDSIDITKPEHAEQRRFMRENASKKGPNGAV--- 65

  Fly    66 EPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAP-ADTTAVSTAQIELKQENGDAKKEE 129
                 ||||.|.:|||.|||:.||.:.|.||:..||:|.| |..:.|:|        ||      
 Worm    66 -----LPPQFFYEDEYLGDYEDFDTSVEADTITEFLRLLPDAIESNVTT--------NG------ 111

  Fly   130 AETEAEDKKTEAGDGDVDVKEEAAEKAENEDGKDKE--NSKGEDEDADEENAEQKTETEESGDKK 192
            ||...:|..|.....|       .:|||.:|.:|:|  ..:||||:..||.:::        :||
 Worm   112 AEAGGDDTGTTTAKSD-------EKKAEEDDEEDEEWDEDEGEDEEEGEEGSKE--------EKK 161

  Fly   193 TEEKTTDAEGETQEKSEEVDTKEKSEVESTKDDEV-GKSEDVKDDEDEKSE 242
            .||:...:|..|..|.|    .:|.|.|..:|:|: |:.|:..:||:|..|
 Worm   162 KEEEVDASETITLAKPE----AKKDEEEVVEDEELEGEDEEWDEDEEEGEE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 44/102 (43%)
Y105E8A.1NP_001263593.1 SH3BGR 2..99 CDD:368184 44/102 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165829
Domainoid 1 1.000 84 1.000 Domainoid score I5323
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I3599
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46667
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - oto18323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12232
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 1 1.000 - - X4396
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1313.000

Return to query results.
Submit another query.