DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and Sh3bgrl2

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_766095.1 Gene:Sh3bgrl2 / 212531 MGIID:1915350 Length:107 Species:Mus musculus


Alignment Length:118 Identity:44/118 - (37%)
Similarity:68/118 - (57%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESE---KELMQNKSTSNGGTV 62
            ||::|:|:..||...:||:||.|:..|::..|:::.||||...::.:   |.:...|..:.|   
Mouse     1 MVVRVFVASCSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNIPPEKKPAQG--- 62

  Fly    63 SDPEPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAPADTTAVSTAQ 115
                  :|||||:||.|.||||||:|..:.|.:|:..||.|.|   ...|||:
Mouse    63 ------NPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKP---RPASTAE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 39/105 (37%)
Sh3bgrl2NP_766095.1 GRX_SH3BGR 2..97 CDD:239328 38/103 (37%)
SH3-binding. /evidence=ECO:0000255 61..67 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9025
eggNOG 1 0.900 - - E1_KOG4023
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm44021
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.