DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and sh3bgrl

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_004916950.1 Gene:sh3bgrl / 101733396 XenbaseID:XB-GENE-994511 Length:117 Species:Xenopus tropicalis


Alignment Length:132 Identity:48/132 - (36%)
Similarity:68/132 - (51%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDP 65
            ||::||::..||:..:||:||.||..|.:..|:::..||. ..:|:.|.:.:|          .|
 Frog     1 MVIRVYIATSSGSTSIKKKQQDVLGFLHAVKIEFEEKDIA-ANEENRKWMREN----------IP 54

  Fly    66 EPRHP-----LPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAPADTTAVSTAQIELKQENGDA 125
            |...|     ||||:|||.:||||||||..|.|.:.:..||.|         ||....|:....|
 Frog    55 EHCRPTSGNSLPPQIFNDSQYCGDYDAFFEARENNAVYAFLGL---------TAPPGSKEAEALA 110

  Fly   126 KK 127
            ||
 Frog   111 KK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 41/107 (38%)
sh3bgrlXP_004916950.1 SH3BGR 1..98 CDD:368184 42/116 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8472
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5053
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 1 1.000 - - otm49196
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.