DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and sh3bgrl

DIOPT Version :10

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_004916950.1 Gene:sh3bgrl / 101733396 XenbaseID:XB-GENE-994511 Length:117 Species:Xenopus tropicalis


Alignment Length:132 Identity:48/132 - (36%)
Similarity:68/132 - (51%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDP 65
            ||::||::..||:..:||:||.||..|.:..|:::..||. ..:|:.|.:.:|          .|
 Frog     1 MVIRVYIATSSGSTSIKKKQQDVLGFLHAVKIEFEEKDIA-ANEENRKWMREN----------IP 54

  Fly    66 EPRHP-----LPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKLAPADTTAVSTAQIELKQENGDA 125
            |...|     ||||:|||.:||||||||..|.|.:.:..||.|         ||....|:....|
 Frog    55 EHCRPTSGNSLPPQIFNDSQYCGDYDAFFEARENNAVYAFLGL---------TAPPGSKEAEALA 110

  Fly   126 KK 127
            ||
 Frog   111 KK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 1..104 CDD:469754 41/107 (38%)
2A1904 <138..392 CDD:273344
sh3bgrlXP_004916950.1 GRX_SH3BGR 2..97 CDD:239328 40/105 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.