DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sh3beta and sh3bgrl3

DIOPT Version :9

Sequence 1:NP_001189057.1 Gene:Sh3beta / 38820 FlyBaseID:FBgn0035772 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001096514.1 Gene:sh3bgrl3 / 100125146 XenbaseID:XB-GENE-965976 Length:93 Species:Xenopus tropicalis


Alignment Length:103 Identity:44/103 - (42%)
Similarity:60/103 - (58%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLKVYVSGMSGNKEVKKRQQRVLMILDSKNIKYDTVDITEPGKESEKELMQNKSTSNGGTVSDP 65
            ||:|||.:.::|::|:|.:|..:..|||||.|||:||||: .......|:.|.....|.      
 Frog     1 MVVKVYYTSVTGSREIKSKQSEITRILDSKCIKYETVDIS-ADNNIRTEMRQMCGNPNA------ 58

  Fly    66 EPRHPLPPQLFNDDEYCGDYDAFDMANEIDTLEVFLKL 103
                 .|||:||||:|||||:.|..|.|.:.|..||||
 Frog    59 -----FPPQIFNDDQYCGDYEQFAAAVEDEILSQFLKL 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sh3betaNP_001189057.1 Thioredoxin_like 1..104 CDD:294274 44/103 (43%)
sh3bgrl3NP_001096514.1 GRX_SH3BGR 2..91 CDD:239328 41/100 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508713at2759
OrthoFinder 1 1.000 - - FOG0000625
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12232
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4755
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.