DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTCF and CG31388

DIOPT Version :9

Sequence 1:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:365 Identity:85/365 - (23%)
Similarity:137/365 - (37%) Gaps:67/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 ERELEELVDEPDISSMVTELS------------DYTVDE-AAVEAATATLTPNEAEVYEFEDNAT 255
            |:.|::..||....|.|.:|:            |...|| |:::..|.|...|   .|:    :.
  Fly    94 EQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDKNTDELASIKTTTTTEYMN---AYQ----SV 151

  Fly   256 TEDENADKKDVDFVLSNKEVKLKTASSTSQNSNA-----SGHKYSCPHCPYTASKKFLITRHS-R 314
            ...:::.:...|..|||:...:..:..:...|.|     :...::|..|.........:..|. .
  Fly   152 ASPQSSPELSTDSQLSNEHFDMGLSPESEPESEAIDNRDTSSSHTCSKCGLEFENVDELKLHKYH 216

  Fly   315 SHDVEP--SFKCSICERSFRSNVGLQNHINTHMGNKP--HKCKLCESAFTTSGELVRHTRYKHTK 375
            .||:.|  .|.|..|:..|||...|..|.|  |.|.|  |.|..|:|.|  ...::..|..:...
  Fly   217 LHDIPPDTKFVCDHCDEGFRSAAALTRHCN--MINLPLTHSCTKCKSQF--HNHILLETHKQRCL 277

  Fly   376 EKP---HKCTECTYASVELTKLRRHMTCHTGERPYQCPHCTYASQDMFKLKRHMVIHTGEKKYQC 437
            ..|   |.|..|.........|:.|:..|.|.|.::|..|:.:.....:|..|...||.|:.|.|
  Fly   278 RPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYIC 342

  Fly   438 DI-CKSRFTQSNSLKAHKLIHSVVDKPVFQCNYCPTTCGRKADLRVHIKHMHTSDVPMTCRRCGQ 501
            .. |...|...::...|:.:|....|.::||.|||         :.::       .|..||    
  Fly   343 RYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCP---------KSYV-------TPSECR---- 387

  Fly   502 QLPDRYQYKLHVKSHEGEKCYSCKLCSYASVTQRHLASHM 541
                     .|.|.|...:.:.|::|..:..|.:|..||:
  Fly   388 ---------THQKYHNLTRDHGCEICRISFKTAKHYRSHL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTCFNP_648109.1 23ISL <116..206 CDD:293226 1/1 (100%)
C2H2 Zn finger 296..316 CDD:275368 3/20 (15%)
COG5048 321..>621 CDD:227381 58/227 (26%)
zf-C2H2 322..344 CDD:278523 9/21 (43%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 337..361 CDD:290200 11/25 (44%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
C2H2 Zn finger 381..401 CDD:275368 4/19 (21%)
zf-H2C2_2 394..415 CDD:290200 7/20 (35%)
C2H2 Zn finger 409..429 CDD:275368 4/19 (21%)
zf-H2C2_2 422..446 CDD:290200 9/24 (38%)
C2H2 Zn finger 437..457 CDD:275368 4/20 (20%)
C2H2 Zn finger 467..485 CDD:275368 4/17 (24%)
C2H2 Zn finger 496..516 CDD:275370 4/19 (21%)
C2H2 Zn finger 524..544 CDD:275368 6/18 (33%)
zf-H2C2_2 536..561 CDD:290200 3/6 (50%)
C2H2 Zn finger 552..573 CDD:275368
zf-C2H2 587..609 CDD:278523
C2H2 Zn finger 589..609 CDD:275368
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 11/27 (41%)
C2H2 Zn finger 286..306 CDD:275368 4/19 (21%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..363 CDD:275368 4/20 (20%)
C2H2 Zn finger 373..393 CDD:275368 9/48 (19%)
C2H2 Zn finger 401..419 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.