DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTCF and Kr

DIOPT Version :9

Sequence 1:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:399 Identity:99/399 - (24%)
Similarity:146/399 - (36%) Gaps:112/399 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KQKELQKKLKQAAAKPGKATRSVVSTATNKSINLRPAKSTPKATTSKP----------------- 148
            ||:::......:.:.|..|..|..|.|.     :.||....:|..:..                 
  Fly    22 KQEDVHLDRSMSLSPPMSANTSATSAAA-----IYPAMGLQQAAAASAFGMLSPTQLLAANRQAA 81

  Fly   149 ------PPEPKAISVRPARAAA---AKAKQSAMPP-------PPA---LVVKVP---------AP 185
                  |....|.::.|...||   |.|.|.::||       |||   ..:..|         :|
  Fly    82 AFMAQLPMSTLANTLFPHNPAALFGAWAAQQSLPPQGTHLHSPPASPHSPLSTPLGSGKHPLNSP 146

  Fly   186 RGRPRKNPVIPKPEPMDLERELEELVDEPDISSMVTELSDYTVDEAAVEAATATLTPNEAEVYEF 250
            ...|:.:....|...:.:::|.     :.:||..|.::  |......:...::..:||       
  Fly   147 NSTPQHHEPAKKARKLSVKKEF-----QTEISMSVNDM--YHTSGGPISPPSSGSSPN------- 197

  Fly   251 EDNATTEDENADKKDVDFVLSNKEVKLKTASSTSQNSNASGHKYSCPHCPYTASKKFLITRHSRS 315
                :|.|                              .:|....|             ...|:.
  Fly   198 ----STHD------------------------------GAGGNAGC-------------VGVSKD 215

  Fly   316 HDVEPSFKCSICERSFRSNVGLQNHINTHMGNKPHKCKLCESAFTTSGELVRHTRYKHTKEKPHK 380
            ...:.||.|.||.|||.....||||..||.|.||.:|..|...||....|..|.|. ||.|||:.
  Fly   216 PSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRL-HTGEKPYH 279

  Fly   381 CTECTYASVELTKLRRHMTCHTGERPYQCPHCTYASQDMFKLKRHMVIHTGEKKYQCDICKSRFT 445
            |:.|....|::..||||:..|||||||.|..|.....|..:||.||::|.|||.::|:.|..:|.
  Fly   280 CSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFR 344

  Fly   446 QSNSLKAHK 454
            :.:.|..||
  Fly   345 RRHHLMNHK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTCFNP_648109.1 23ISL <116..206 CDD:293226 25/134 (19%)
C2H2 Zn finger 296..316 CDD:275368 2/19 (11%)
COG5048 321..>621 CDD:227381 60/134 (45%)
zf-C2H2 322..344 CDD:278523 11/21 (52%)
C2H2 Zn finger 324..344 CDD:275368 10/19 (53%)
zf-H2C2_2 337..361 CDD:290200 12/23 (52%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
zf-H2C2_2 394..415 CDD:290200 13/20 (65%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
zf-H2C2_2 422..446 CDD:290200 11/23 (48%)
C2H2 Zn finger 437..457 CDD:275368 6/18 (33%)
C2H2 Zn finger 467..485 CDD:275368
C2H2 Zn finger 496..516 CDD:275370
C2H2 Zn finger 524..544 CDD:275368
zf-H2C2_2 536..561 CDD:290200
C2H2 Zn finger 552..573 CDD:275368
zf-C2H2 587..609 CDD:278523
C2H2 Zn finger 589..609 CDD:275368
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 10/19 (53%)
zf-H2C2_2 237..261 CDD:290200 12/23 (52%)
C2H2 Zn finger 252..272 CDD:275368 7/20 (35%)
zf-H2C2_2 264..289 CDD:290200 10/25 (40%)
C2H2 Zn finger 280..300 CDD:275368 7/19 (37%)
zf-H2C2_2 292..316 CDD:290200 13/23 (57%)
C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
zf-H2C2_2 321..345 CDD:290200 11/23 (48%)
C2H2 Zn finger 336..352 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.