DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTCF and Kr-h1

DIOPT Version :9

Sequence 1:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:764 Identity:160/764 - (20%)
Similarity:252/764 - (32%) Gaps:243/764 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SKPPPEPKAISVRPARAAAA-------------KAKQSAMP------PPPALVVKVPAPRGRPRK 191
            ||.|.:..|:...||:.:|.             |.:||:..      |||..........|.|  
  Fly    33 SKSPAKAVAVKKSPAKDSATTKMVYYSANQLLIKTEQSSQAQFCLQVPPPLTATTTSVGLGVP-- 95

  Fly   192 NPVIPKPEPMDLERELEELVDEPDISSMVTELSDYTVDEAA--VEAATATLTPNEAEVYEFEDNA 254
                    |...::|..||:..|....|..:|.|....|..  |....|.....:.:..:..::.
  Fly    96 --------PSGGQQEHFELLQTPQQRQMQLQLQDQHQQEQQQFVSYQLAIQQHQKQQQQQQHESI 152

  Fly   255 TTEDENADKKDVDFVLSNKEVKLK-------TASSTSQ--NSNASGHKYSCPHCPYTASKKFLIT 310
            |.....|       ..|.:.:|.:       :|:..||  ..:||..::.|..|..|...|...|
  Fly   153 TNAAPTA-------APSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHT 210

  Fly   311 RHSRSHD----------------------------------------VEP---------SFKCSI 326
            .|::||.                                        ::|         .::|::
  Fly   211 SHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNV 275

  Fly   327 CERSFRSNVGLQNHINTHMGNKPHKCKLCESAFTTSGELVRHTRYKHTKEKPHKCTECTYASVEL 391
            |:::|.....|..|..||.|.:|.:|:.|...|:....|..|.|. ||||:|:||..|..|....
  Fly   276 CQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRI-HTKERPYKCDVCGRAFEHS 339

  Fly   392 TKLRRHMTCHTGERPYQCPHCTYASQDMFKLKRHMVIHTGEKKYQCDI--CKSRFTQSNSLKAHK 454
            .||.|||..||||||::|..|........:|..||..|||||.|:|..  |...||.|..||.| 
  Fly   340 GKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVH- 403

  Fly   455 LIHSVVDKPVFQCNYCPTTCGRKADLRVHIKHMHTSDVPMTCRRCGQQLPDRYQYKLHVKSHEGE 519
                                          ...||.:.|..|..|.:.....:..|||...|.|.
  Fly   404 ------------------------------SRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGS 438

  Fly   520 KCYSCKLCSYASVTQRHLASHMLIHLDEKPFHCDQCPQAFRQ----------------RQLLRRH 568
            |||.|.:|......::.:.:|:..|.:|.|  .|:...|...                :.:....
  Fly   439 KCYKCTICDETFKNKKEMEAHIKGHANEVP--DDEAEAAAASAAASTSAGSSAGSPSLQGVSSNS 501

  Fly   569 MNLVHNEEYQPP---EPRE----KLHK-----------CPSCPREFTHKGNLMRHMETHDDSANA 615
            .:..|:....||   :||:    ::.|           .|..|...:         .|:..||::
  Fly   502 ESSNHSPPSSPPATKKPRQARQPRVSKTVAATLSIPTSSPLSPSSLS---------STYSPSASS 557

  Fly   616 R-----EKRRRLKLGRNVRLQKDGTVITLIKDQYVDMDRDQEENEEDDNPESYDLAEIE---PEN 672
            .     .....|.    |:::.|    .|.:|..|...:.......|:.|....:.:::   ||:
  Fly   558 MASPPPTSAHYLP----VQMEAD----ALSRDSGVSSAQPAHSTYADEEPTDLSMQQVQGQLPES 614

  Fly   673 SEAEDADDDVETIVSDPIRQRIKPAP--IIINKQARLAASEKQPMIINQRLRSQRGTKTFHIKEE 735
            :        |:...:.|....::|.|  :.||.....|||                     |...
  Fly   615 T--------VDYYQAPPSLLELQPQPAGLTINPALLEAAS---------------------IARR 650

  Fly   736 PDNSDFTVE--------WQGDDGEVMVVELVNG------DEEVLVKHEP 770
            .|::|..|:        ||       :::|..|      .|:....|:|
  Fly   651 HDDNDDQVQDEDVHAAAWQ-------MMQLCRGHGSLPPTEQPAPSHQP 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTCFNP_648109.1 23ISL <116..206 CDD:293226 16/78 (21%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
COG5048 321..>621 CDD:227381 86/340 (25%)
zf-C2H2 322..344 CDD:278523 5/21 (24%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
zf-H2C2_2 337..361 CDD:290200 9/23 (39%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 8/19 (42%)
zf-H2C2_2 394..415 CDD:290200 12/20 (60%)
C2H2 Zn finger 409..429 CDD:275368 5/19 (26%)
zf-H2C2_2 422..446 CDD:290200 12/25 (48%)
C2H2 Zn finger 437..457 CDD:275368 8/21 (38%)
C2H2 Zn finger 467..485 CDD:275368 0/17 (0%)
C2H2 Zn finger 496..516 CDD:275370 5/19 (26%)
C2H2 Zn finger 524..544 CDD:275368 3/19 (16%)
zf-H2C2_2 536..561 CDD:290200 6/24 (25%)
C2H2 Zn finger 552..573 CDD:275368 2/36 (6%)
zf-C2H2 587..609 CDD:278523 3/32 (9%)
C2H2 Zn finger 589..609 CDD:275368 2/19 (11%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 6/19 (32%)
COG5048 <270..420 CDD:227381 59/181 (33%)
zf-C2H2 271..293 CDD:278523 5/21 (24%)
C2H2 Zn finger 273..293 CDD:275368 5/19 (26%)
zf-H2C2_2 286..309 CDD:290200 8/22 (36%)
C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
zf-H2C2_2 313..338 CDD:290200 12/25 (48%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
zf-H2C2_2 370..396 CDD:290200 12/25 (48%)
C2H2 Zn finger 385..407 CDD:275368 8/52 (15%)
zf-H2C2_2 400..424 CDD:290200 8/54 (15%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-C2H2 441..463 CDD:278523 4/21 (19%)
C2H2 Zn finger 443..463 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.