DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTCF and CG18262

DIOPT Version :9

Sequence 1:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:375 Identity:105/375 - (28%)
Similarity:158/375 - (42%) Gaps:74/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VVKVPAPRGRPRKNPVIPKPEPMDLERELEE-------------------LVDEPDISSMVTELS 224
            ||:|   :|....:..:.|....|||.|.||                   ||:..:      :|.
  Fly    76 VVEV---QGNEELHEELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNTLVETRE------DLL 131

  Fly   225 DYTVDEAAVEAATATLTPNEAEVYEFEDNATTEDENADKKDVDF--------------VLSNKEV 275
            |..:|....|.:....|..|.|....:|:  |:|.| |.||:.|              :.|::.:
  Fly   132 DIELDWTGGEQSEHNETHEEEEGESDDDD--TKDSN-DTKDMLFQCDQCDRAYNTKRSLQSHRRL 193

  Fly   276 KLKTASSTSQNSNASGHKYSCPHCPYTASKKFLITRHSRSHDVEPS-FKCS--ICERSFRSNVGL 337
            |...|:..|.:.:||                   .|:|:.....|. :||:  .|.::||:...|
  Fly   194 KHSEANGGSLDKSAS-------------------ERNSKKRKGPPKVYKCNEEACNQTFRTERDL 239

  Fly   338 QNHINTHMGNKPHKCKLCESAFTTSGELVRHTRYKHTKEKPHKCTECTYASVELTKLRRHMTCHT 402
            :.|...|.|   ..|.:|...||.||.::|| |.:|:..|||||.||........:|..|..|||
  Fly   240 RGHRWKHTG---IFCDICGKPFTQSGNMMRH-RQRHSGIKPHKCPECDATFYTQKELSSHSICHT 300

  Fly   403 GERPYQCPHCTYASQDMFKLKRHMVIHTGEKKYQCDICKSRFTQSNSLKAHKLIHSVVDKPVFQC 467
            |..|..|..|....:|...|..||..||||:..:|::|...|...:.|..|.:.|:.: :| |.|
  Fly   301 GRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNL-RP-FVC 363

  Fly   468 NYCPTTCGRKADLRVHIKHMHTSDVPMTCRRCGQQLPDRYQYKLHVKSHE 517
            :.|.:|..||..|||| |.:|:......|:.||:..........|::||:
  Fly   364 DVCGSTFQRKKALRVH-KLLHSEQRKYACKLCGKTFAQSGGLNAHMRSHD 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTCFNP_648109.1 23ISL <116..206 CDD:293226 8/26 (31%)
C2H2 Zn finger 296..316 CDD:275368 2/19 (11%)
COG5048 321..>621 CDD:227381 68/200 (34%)
zf-C2H2 322..344 CDD:278523 7/23 (30%)
C2H2 Zn finger 324..344 CDD:275368 6/21 (29%)
zf-H2C2_2 337..361 CDD:290200 7/23 (30%)
C2H2 Zn finger 352..373 CDD:275368 9/20 (45%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
zf-H2C2_2 394..415 CDD:290200 9/20 (45%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
zf-H2C2_2 422..446 CDD:290200 10/23 (43%)
C2H2 Zn finger 437..457 CDD:275368 5/19 (26%)
C2H2 Zn finger 467..485 CDD:275368 9/17 (53%)
C2H2 Zn finger 496..516 CDD:275370 4/19 (21%)
C2H2 Zn finger 524..544 CDD:275368
zf-H2C2_2 536..561 CDD:290200
C2H2 Zn finger 552..573 CDD:275368
zf-C2H2 587..609 CDD:278523
C2H2 Zn finger 589..609 CDD:275368
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/21 (29%)
C2H2 Zn finger 251..271 CDD:275368 9/20 (45%)
COG5048 <256..415 CDD:227381 57/161 (35%)
zf-H2C2_2 263..288 CDD:290200 11/25 (44%)
C2H2 Zn finger 279..327 CDD:275368 16/47 (34%)
zf-H2C2_2 320..342 CDD:290200 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 10/20 (50%)
zf-C2H2 389..411 CDD:278523 4/21 (19%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.