DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTCF and ZNF420

DIOPT Version :9

Sequence 1:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001316444.1 Gene:ZNF420 / 147923 HGNCID:20649 Length:704 Species:Homo sapiens


Alignment Length:418 Identity:129/418 - (30%)
Similarity:197/418 - (47%) Gaps:26/418 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 MDLERELEELVD--EPDI--SSMVTELSDYTVDEAAVEAATATLTPNEAEVYEFEDNATTEDENA 261
            :|..:|..|.:|  :.|:  ..|:...|:....:.....|:..|:| |...||.|   .::.|.:
Human    13 IDFSQEEWECLDSAQRDLYRDVMLENYSNLVSLDLPSRCASKDLSP-EKNTYETE---LSQWEMS 73

  Fly   262 DK-KDVDFVLSNKEVKLKTASSTSQNSNASGHKYSCPHCPYTASKKF----LITRHSRSHDVEPS 321
            |: ::.|...||....|:......:........:......|.....|    .:::|||.|..|..
Human    74 DRLENCDLEESNSRDYLEAKGKMEKQQENQKEYFRQGMIIYDKMSIFNQHTYLSQHSRCHSTEKP 138

  Fly   322 FKCSICERSFRSNVGLQNHINTHMGNKPHKCKLCESAFTTSGELVRHTRYKHTKEKPHKCTECTY 386
            :||..|.::||....|..|.:.|.|.||::||.|..||:...:|..|.|. ||.|||:.|.||..
Human   139 YKCKECGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRL-HTGEKPYACKECGK 202

  Fly   387 ASVELTKLRRHMTCHTGERPYQCPHCTYASQDMFKLKRHMVIHTGEKKYQCDICKSRFTQSNSLK 451
            |..:.::|..|...||||:||:|..|..|.....:|.||..:|||||.|:|..|...|||::.|.
Human   203 AFTQSSQLILHHRIHTGEKPYKCEECGKAFIRSSQLTRHQKVHTGEKPYECKECGKAFTQNSQLT 267

  Fly   452 AHKLIHSVVDKPVFQCNYCPTTCGRKADLRVHIKHMHTSDVPMTCRRCGQQLPDRYQYKLHVKSH 516
            .|:.:|:  .:.:::|..|.....:.:.|.:| |.:||.:.|..|:.||:......|...|.|.|
Human   268 LHQRLHT--GEKLYECKECRKVFTQLSQLILH-KRIHTGEKPYECKECGKAFICGSQLSQHQKIH 329

  Fly   517 EGEKCYSCKLCSYASVTQRHLASHMLIHLDEKPFHCDQCPQAFRQRQLLRRHMNLVHNEEYQPPE 581
            .|||.|.||.|..|.:....|..|..||..|||:.|::|.:||.:...|.:|..:..|       
Human   330 NGEKPYECKECGRAFIRGSLLMQHQRIHTGEKPYKCEECGKAFIRGSQLTQHQRIHTN------- 387

  Fly   582 PREKLHKCPSCPREFTHKGNLMRHMETH 609
              ||.::|..|.:.|:|...|.:|...|
Human   388 --EKPYECKECGKMFSHGSQLTQHQRIH 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTCFNP_648109.1 23ISL <116..206 CDD:293226 1/4 (25%)
C2H2 Zn finger 296..316 CDD:275368 5/23 (22%)
COG5048 321..>621 CDD:227381 102/289 (35%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 337..361 CDD:290200 11/23 (48%)
C2H2 Zn finger 352..373 CDD:275368 8/20 (40%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
zf-H2C2_2 394..415 CDD:290200 10/20 (50%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
zf-H2C2_2 422..446 CDD:290200 12/23 (52%)
C2H2 Zn finger 437..457 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..485 CDD:275368 4/17 (24%)
C2H2 Zn finger 496..516 CDD:275370 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368 6/19 (32%)
zf-H2C2_2 536..561 CDD:290200 11/24 (46%)
C2H2 Zn finger 552..573 CDD:275368 6/20 (30%)
zf-C2H2 587..609 CDD:278523 6/21 (29%)
C2H2 Zn finger 589..609 CDD:275368 6/19 (32%)
ZNF420NP_001316444.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.