DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and ERG20

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_012368.1 Gene:ERG20 / 853272 SGDID:S000003703 Length:352 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:63/295 - (21%)
Similarity:119/295 - (40%) Gaps:74/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EKLAQIGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGV-------ASTINAANYALFLALE 113
            ||:|.:|..:::|....|:.||:.|.||.|||.|..:.:..|       |..:.||.|.|..:..
Yeast    80 EKVAILGWCIELLQAYFLVADDMMDKSITRRGQPCWYKVPEVGEIAINDAFMLEAAIYKLLKSHF 144

  Fly   114 KVQQLDHPEATKVYTEQLLELHRGQGMEIYWRDSFTCPSES-DYKLMTVRKTGGL---------F 168
            :.::. :.:.|:::.|...:...||.|     |..|.|.:. |....:::|...:         |
Yeast   145 RNEKY-YIDITELFHEVTFQTELGQLM-----DLITAPEDKVDLSKFSLKKHSFIVTFKTAYYSF 203

  Fly   169 MLAIRLMQLFS--SNKEDYSKLTAI---LGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFP 228
            .|.:.|....:  ::::|..:...:   ||.||||:|||.:.                   ||.|
Yeast   204 YLPVALAMYVAGITDEKDLKQARDVLIPLGEYFQIQDDYLDC-------------------FGTP 249

  Fly   229 -VIHAVRTQKQDKQVLHIL----------RQRTHD---------IEVKKYCITLLEKLGSFQYTR 273
             .|..:.|..||.:...::          :::|.|         .|.|  |..:...|...|...
Yeast   250 EQIGKIGTDIQDNKCSWVINKALELASAEQRKTLDENYGKKDSVAEAK--CKKIFNDLKIEQLYH 312

  Fly   274 KVLESLDAEARSEVARLGSN-----PYMDRLLNKL 303
            :..||:..:.:::::::..:     ..:...|||:
Yeast   313 EYEESIAKDLKAKISQVDESRGFKADVLTAFLNKV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 56/252 (22%)
ERG20NP_012368.1 polyprenyl_synt 38..305 CDD:395277 56/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.