DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and GGPS6

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_175376.1 Gene:GGPS6 / 841377 AraportID:AT1G49530 Length:336 Species:Arabidopsis thaliana


Alignment Length:275 Identity:73/275 - (26%)
Similarity:118/275 - (42%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IILQKTKDKSTQKEQDEI---------LLQPFTYIQQ------IP-GKQFRSELALAFNHWLLIP 54
            |...|.|.||..|..|..         |.:|...:.:      :| ||:.|..|.|....  |:.
plant    33 ISYMKNKAKSINKALDNSIPLCNNFVPLWEPVLEVHKAMRYTLLPGGKRVRPMLCLVACE--LVG 95

  Fly    55 GEKLAQI--GDIVQMLHNSSLLIDDIE--DNSILRRGVPVAHSIYGVASTINAANYALFLAL--- 112
            |::...:  ...|:|:|.:||::||:.  |:..||||.|..|.::|..::|.|:|....||:   
plant    96 GQESTAMPAACAVEMIHAASLILDDLPCMDDDSLRRGKPTNHKVFGEKTSILASNALRSLAVKQT 160

  Fly   113 ----------EKVQQLDHPEATKVYTEQLLELHRGQGMEIYW-RDSFTCPSESD----YKLMTVR 162
                      |:|.:.....|..|.||.|:   .||..::.. |.||  .:|.|    .:||.|.
plant   161 LASTSLGVTSERVLRAVQEMARAVGTEGLV---AGQAADLAGERMSF--KNEDDELRYLELMHVH 220

  Fly   163 KTGGLFMLAIRLMQLF-SSNKEDYSKLTA---ILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEG 223
            ||..|...|..:..:. ..:.|:..:|.:   .:||.||:.||..:.:.......|:..:||..|
plant   221 KTAVLVEAAAVVGAIMGGGSDEEIERLKSYARCVGLMFQVMDDVLDETKSSEELGKTAGKDLITG 285

  Fly   224 KFGFPVIHAVRTQKQ 238
            |..:|.:..|...::
plant   286 KLTYPKVMGVDNARE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 64/242 (26%)
GGPS6NP_175376.1 Trans_IPPS_HT 67..334 CDD:173833 64/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.