DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and GGR

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_195558.1 Gene:GGR / 830002 AraportID:AT4G38460 Length:326 Species:Arabidopsis thaliana


Alignment Length:205 Identity:52/205 - (25%)
Similarity:80/205 - (39%) Gaps:51/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LIPGEKLAQI--GDIVQMLHNSSLLIDDIE--DNSILRRGVPVAHSIYGVASTINAANYALF-LA 111
            |..|::||..  ...::|:|.:||:.||:.  |:..:|||.|..|::||....|.|.: ||| ||
plant   101 LFGGDRLAAFPTACALEMVHAASLIHDDLPCMDDDPVRRGKPSNHTVYGSGMAILAGD-ALFPLA 164

  Fly   112 LEKVQQLDH------PEATKVYTEQLLELHRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFML 170
            .:.:  :.|      |.||  ....:.|:.|..|.        |..:...|    |...||.|.|
plant   165 FQHI--VSHTPPDLVPRAT--ILRLITEIARTVGS--------TGMAAGQY----VDLEGGPFPL 213

  Fly   171 AIRLMQLFSSNKEDYSKLTAIL------------------GLYFQIRDDYCNLSLKEYTEN---- 213
            :....:.|.:..|..:....:|                  |:.:|:.||......|.|...    
plant   214 SFVQEKKFGAMGECSAVCGGLLGGATEDELQSLRRYGRAVGMLYQVVDDITEDKKKSYDGGAEKG 278

  Fly   214 -KSFAEDLTE 222
             ...||:|.|
plant   279 MMEMAEELKE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 52/205 (25%)
GGRNP_195558.1 IspA 55..>263 CDD:223220 45/178 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.