DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and GGPS1

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_195399.1 Gene:GGPS1 / 829834 AraportID:AT4G36810 Length:371 Species:Arabidopsis thaliana


Alignment Length:318 Identity:68/318 - (21%)
Similarity:113/318 - (35%) Gaps:80/318 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILQKTKDKSTQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQI--GDIVQMLH 69
            ::.|..|.:....:...:.:...|.....||:.|..|.:|...  |:.||:...:  ...|:|:|
plant    86 LVNKALDSAVPLREPLKIHEAMRYSLLAGGKRVRPVLCIAACE--LVGGEESTAMPAACAVEMIH 148

  Fly    70 NSSLLIDDIE--DNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPE---------- 122
            ..||:.||:.  ||..||||.|..|.::|....:.|.:..|..|.|.:......:          
plant   149 TMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALLSFAFEHLASATSSDVVSPVRVVRA 213

  Fly   123 ----ATKVYTEQLLELHRGQGMEIYWRDSFTCPSE---------SDYKLMTVRKTGGLFMLAIRL 174
                |..:.||.|:   .||.::|        .||         ...:.:.:.||..|...:..|
plant   214 VGELAKAIGTEGLV---AGQVVDI--------SSEGLDLNDVGLEHLEFIHLHKTAALLEASAVL 267

  Fly   175 MQLFSSNKED----YSKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRT 235
            ..:.....:|    ..|....:||.||:.||..:::.......|:..:||...|..:|.|..   
plant   268 GAIVGGGSDDEIERLRKFARCIGLLFQVVDDILDVTKSSKELGKTAGKDLIADKLTYPKIMG--- 329

  Fly   236 QKQDKQVLHILRQRTHDIEVKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSN 293
                                       |||      :|:..|.|:.|||.::....|:
plant   330 ---------------------------LEK------SREFAEKLNREARDQLLGFDSD 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 59/267 (22%)
GGPS1NP_195399.1 Trans_IPPS_HT 103..369 CDD:173833 66/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.