DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and AT3G29430

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_189589.1 Gene:AT3G29430 / 822604 AraportID:AT3G29430 Length:357 Species:Arabidopsis thaliana


Alignment Length:315 Identity:67/315 - (21%)
Similarity:119/315 - (37%) Gaps:69/315 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILQKTKDKSTQKEQDEILLQPFT------YIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGD-- 63
            :::|.:..|........|.:|.|      |.....||:.|..|.:|...  |:.|::...:..  
plant    67 MIRKAESVSAALNVSVPLQEPLTIQEAVRYSLLAGGKRVRPLLCIAACE--LVGGDEATAMSAAC 129

  Fly    64 IVQMLHNSSLLIDDIE--DNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDH----PE 122
            .|:|:|.|||:.||:.  |::.||||.|..|..:|....:.|.:..|.||.|.:..:.:    ||
plant   130 AVEMIHTSSLIHDDLPCMDDADLRRGKPTNHKEFGEDMAVLAGDALLALAFEHMTFVSNGLVAPE 194

  Fly   123 ATKVYTEQLLELHRGQGME--IYWRDSFTC-----PSE---SDYKLMTVRKTGGLFMLAIRLMQL 177
            .   ....::||.:..|.:  :..:.:..|     |.:   ...:.:.:.||..|...|..|..:
plant   195 R---MIRAVMELAKAIGTKGLVAGQVTDLCSQGLNPDDVGLERLEFIHLHKTAALLEAAAVLGAI 256

  Fly   178 FSSNKED----YSKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQ 238
            .....|:    ..|....:||.||:.||..:::.......|:..:|:..||..:|          
plant   257 MGGGTEEEIEKLRKYARCIGLLFQVVDDILDVTESTKELGKTAGKDVMAGKLTYP---------- 311

  Fly   239 DKQVLHILRQRTHDIEVKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSN 293
                                      :|...:.:|:|.|.|..||..::....|:
plant   312 --------------------------RLIGLERSREVAEKLRREAAEQLLGFDSD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 54/258 (21%)
AT3G29430NP_189589.1 Trans_IPPS_HT 85..355 CDD:173833 64/297 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.