DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and AT3G20160

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_188651.1 Gene:AT3G20160 / 821560 AraportID:AT3G20160 Length:344 Species:Arabidopsis thaliana


Alignment Length:281 Identity:75/281 - (26%)
Similarity:123/281 - (43%) Gaps:48/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KDKSTQKEQDEI--LLQPFTYIQQI-------PGKQFRSELALAFNHWLLIPGEKLAQIGD--IV 65
            |.||..|..:|.  |.:|...|::.       .||:.|..|.||...  |:.|::...:..  .:
plant    57 KAKSVNKALEEAVPLREPELKIREAMRYTLLSDGKRVRPMLCLAACE--LVGGQESTAMSAACAI 119

  Fly    66 QMLHNSSLLIDDIE--DNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQ---LDHPEATK 125
            :|||.|||::||:.  ||..||||.|..|.::|.:..|.|:...:.||::|...   .|.|....
plant   120 EMLHASSLILDDLPCMDNDSLRRGKPTNHIVFGESIAILASQALIALAVQKTTSSTFADVPPERI 184

  Fly   126 VYTEQLLELHR--------------GQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQ 176
            :.|.|  |:.:              |:||..   ||.|.....::  :.:.||..|...|..:..
plant   185 LKTVQ--EMVKAVEGLVAGQQADLAGEGMRF---DSDTGLEHLEF--IHIHKTAALLEAAAVMGA 242

  Fly   177 LF-SSNKEDYSKLTA---ILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQK 237
            :. ..:.|:..:|.:   .:||.||:.||..:::.......|:..:||..||..:|.:..|...|
plant   243 IMGGGSDEEIERLRSYARCIGLMFQVVDDVLDVTKSSEELGKTAGKDLIAGKLTYPRLMGVEKSK 307

  Fly   238 QDKQVLHILRQRTH----DIE 254
            :..:.|:| ..|.|    ||:
plant   308 EYAERLNI-EAREHLLGFDID 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 68/261 (26%)
AT3G20160NP_188651.1 Trans_IPPS_HT 78..342 CDD:173833 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.